PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa16g028030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 275aa    MW: 31256.8 Da    PI: 10.3113
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa16g028030.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind38.34.5e-1221311125
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki.....rernlalsekkaav...........aerd........maflqrdkalaern 71 
                     md+dg  +rn+gyyep+ +++ nlg+ql+   ++r++k+     +++n+++++++  +            +rd        m++    ++l++  
  Csa16g028030.1   2 MDEDGLSNRNWGYYEPS-QFRPNLGFQLI---PDRNEKPfvvspQNQNQNFITPSVLYrgggsssslmsFPRDytasdapfMSY----SWLNK-- 86 
                     9***************9.*********96...6888888888999999999999988866655555544344455555555555....66666.. PP

       GAGA_bind  72 kalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsave 125
                         +rd+k++++++++ s ++++      +++t+ + +  ql +p++ed++ +
  Csa16g028030.1  87 ----HRDSKFFSNVPNNPS-NHHN----LLVRETSRMTQPMQLLQPEVEDESLK 131
                     ....***********6665.4444....45566666655555577788877766 PP

2GAGA_bind269.91.3e-82131274151301
       GAGA_bind 151 kkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPL 244
                     k        +++++ ++k k+ek+ k++++ +++ ers   +ksi++v+ngvs+D++ lPvPvCsCtG+++qCY+WG+GGWqSaCCtt++S+yPL
  Csa16g028030.1 131 K--------RKHQRGAPKAKKEKKLKDNNMLRVQrERSPLFRKSIEMVINGVSMDIGCLPVPVCSCTGMPQQCYRWGCGGWQSACCTTNVSMYPL 217
                     2........222222444444444555555555558999******************************************************** PP

       GAGA_bind 245 PvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     P+s+krrgaRiagrKmSqgaf+k+LekL+a+G+d+s p+DLk+hWAkHGtnkfvtir
  Csa16g028030.1 218 PISAKRRGARIAGRKMSQGAFRKVLEKLSADGFDFSIPIDLKSHWAKHGTNKFVTIR 274
                     ********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062175.4E-812274IPR010409GAGA-binding transcriptional activator
SMARTSM012262.9E-1362274IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MMDEDGLSNR NWGYYEPSQF RPNLGFQLIP DRNEKPFVVS PQNQNQNFIT PSVLYRGGGS  60
SSSLMSFPRD YTASDAPFMS YSWLNKHRDS KFFSNVPNNP SNHHNLLVRE TSRMTQPMQL  120
LQPEVEDESL KRKHQRGAPK AKKEKKLKDN NMLRVQRERS PLFRKSIEMV INGVSMDIGC  180
LPVPVCSCTG MPQQCYRWGC GGWQSACCTT NVSMYPLPIS AKRRGARIAG RKMSQGAFRK  240
VLEKLSADGF DFSIPIDLKS HWAKHGTNKF VTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0125631e-133AC012563.7 Arabidopsis thaliana chromosome 1 BAC T23K23 genomic sequence, complete sequence.
GenBankAY3805691e-133AY380569.1 Arabidopsis thaliana basic pentacysteine 3 (BPC3) mRNA, complete cds.
GenBankBT0221171e-133BT022117.1 Arabidopsis thaliana At1g68120 mRNA, complete cds.
GenBankCP0026841e-133CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010470741.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like isoform X1
RefseqXP_010470742.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like isoform X2
SwissprotQ9C9X61e-153BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLR0GFA21e-169R0GFA2_9BRAS; Uncharacterized protein
STRINGAT1G68120.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.11e-138basic pentacysteine 3